Protein coding transcript 83466

• Transcript: Ll_transcript_278598
• CDS coordinates: 177-485 (+)
• Peptide sequence: MKWKFRALDHQTLLVKVAMAFTRSTLILAILCFILAHELEINDGKQYIMVAAQHIDCMGKCNYRCSKASRENICLRACNSCCQRCSCVPPGTAGNKDMCPCYA
• ORF Type: 3prime_partial

Annotations of Ll_transcript_278598

• Blastp: Gibberellin-regulated protein 3 from Arabidopsis with 75.51% of identity
• Blastx: Gibberellin-regulated protein 3 from Arabidopsis with 75.51% of identity
• Eggnog: gibberellic acid mediated signaling pathway(ENOG410YT52)
• Kegg: Link to kegg annotations (AT4G09600)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019439174.1)
• Pfam: Gibberellin regulated protein (PF02704.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;