Transcript | Ll_transcript_279659 |
---|---|
CDS coordinates | 193-846 (+) |
Peptide sequence | MQKHHYCITMEKIEEEVAKVIEEAKDVEDLVSVHISKTINDEQTLRQRVLTLHSKIHSLRSSLYSLLPNNTTLAEKLDEDLERARCIVVDGDAATFLPAHAQGNFLRMFIGPINVRASRKDVQLKVKEEYNSYRDRTALLFLLFPALLLILRSSVWDGCLPAFPVQIYLAWLLFLYTGLALRENILRVNGSDIRPWYIHSFLYAGFVKGTFVYNDLP* |
ORF Type | complete |
Blastp | Transmembrane protein 120 homolog from Dictyostelium with 29.17% of identity |
---|---|
Blastx | Transmembrane protein 120 homolog from Dictyostelium with 41.41% of identity |
Eggnog | Transmembrane protein 120B(ENOG410XT6G) |
Kegg | Link to kegg annotations (DDB_G0288699) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019427661.1) |
Pfam | TMPIT-like protein (PF07851.12) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer