Protein coding transcript 83690

• Transcript: Ll_transcript_279121
• CDS coordinates: 394-744 (+)
• Peptide sequence: MLSLEYPSTRVSSSKHEEDSGIETGFDSKQFSVVASNVDGSVDDSDALNEDFDVEVEVGNVTKLVKREPLTKGKKVSCYWCFKGNRFTEKEVCLVCDAKYCSSYVLRAIGVEVNKQ*
• ORF Type: complete

Annotations of Ll_transcript_279121

• Blastp: Extra-large guanine nucleotide-binding protein 1 from Arabidopsis with 49.12% of identity
• Blastx: Extra-large guanine nucleotide-binding protein 1 from Arabidopsis with 48.34% of identity
• Eggnog: Guanine nucleotide binding protein (G protein) alpha(ENOG410XNVQ)
• Kegg: Link to kegg annotations (AT2G23460)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019420820.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;