Protein coding transcript 83693

• Transcript: Ll_transcript_279123
• CDS coordinates: 720-1130 (+)
• Peptide sequence: MDKEKRESETIVNDEDDNNCWWWLVQKGTAVTFVTIALFGFLIRVAVSIYPYSGAGNPPKFGDYEAQRHWMEITINLPIREWYRNSSSNDLSYWGLDYPPLTAYQSFFHGFFLDSSTLTLFRFSLPDVTNPIFESY*
• ORF Type: complete

Annotations of Ll_transcript_279123

• Blastp: Probable dolichyl pyrophosphate Man9GlcNAc2 alpha-1,3-glucosyltransferase from Arabidopsis with 70.53% of identity
• Blastx: Probable dolichyl pyrophosphate Man9GlcNAc2 alpha-1,3-glucosyltransferase from Arabidopsis with 70.53% of identity
• Eggnog: asparagine-linked glycosylation 6, alpha-1,3-glucosyltransferase homolog (S. cerevisiae)(ENOG410XQK1)
• Kegg: Link to kegg annotations (AT5G38460)
• CantataDB: Link to cantataDB annotations (CNT0002393)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019442798.1)
• Pfam: ALG6, ALG8 glycosyltransferase family (PF03155.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;