Protein coding transcript 83696

• Transcript: Ll_transcript_279109
• CDS coordinates: 3-545 (+)
• Peptide sequence: QNCPNPPKKLSPGNYWYDKVSGLWGKEGQKPSSIISAHLNVGGAIEPDASNGNTQVFINGREITKVELRMLQLAGVQCAGNPHFWVNEDGSYQEEGQKNTRGYIWGKPGTKLVCAFLSLPVPTKSSNSYGEQHSNLVNRTVPDYLEHGIVQKLLLVGCSGSGTSTIFKQVFSFYSQLSVN*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_279109

• Blastp: Extra-large guanine nucleotide-binding protein 1 from Arabidopsis with 76.4% of identity
• Blastx: Extra-large guanine nucleotide-binding protein 1 from Arabidopsis with 76.4% of identity
• Eggnog: Guanine nucleotide binding protein (G protein) alpha(ENOG410XNVQ)
• Kegg: Link to kegg annotations (AT2G23460)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019447166.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;