Protein coding transcript 83782

• Transcript: Ll_transcript_279376
• CDS coordinates: 1-393 (+)
• Peptide sequence: RYRRLDGRMTLLARDKAVKDFNTDPEVTVMLMSLKAGNLGLNMVAACHVILLDLWWNPTTEDQAVDRAHRIGQTRPVTVTRLTIKDTVEDRILALQEEKRKMVASAFGEDHAGGTATRLTVDDLKYLFMV*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_279376

• Blastp: Helicase-like transcription factor CHR28 from Arabidopsis with 86.05% of identity
• Blastx: Helicase-like transcription factor CHR28 from Arabidopsis with 86.05% of identity
• Eggnog: Transcription termination factor, RNA polymerase II(ENOG410XPDU)
• Kegg: Link to kegg annotations (AT1G50410)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019427503.1)
• Pfam: Helicase conserved C-terminal domain (PF00271.30)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;