Protein coding transcript 83784

• Transcript: Ll_transcript_279359
• CDS coordinates: 685-1119 (+)
• Peptide sequence: MLDLLEECLKKFSIQYRRLDGTMSVVARDKAVKDFNTLPEVSVMIMSLKAASLGLNMVAACHVLMLDLWWNPTTEDQAIDRAHRIGQTRPVTVLRLTVRDTVEDRILALQQKKRKMVASAFGEDGTGGTESRLTVDDLKYLFMM*
• ORF Type: complete

Annotations of Ll_transcript_279359

• Blastp: Helicase-like transcription factor CHR28 from Arabidopsis with 75% of identity
• Blastx: Helicase-like transcription factor CHR28 from Arabidopsis with 55.06% of identity
• Eggnog: Transcription termination factor, RNA polymerase II(ENOG410XPDU)
• Kegg: Link to kegg annotations (AT1G50410)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019423650.1)
• Pfam: Helicase conserved C-terminal domain (PF00271.30)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;