Protein coding transcript 8381

• Transcript: Ll_transcript_425474
• CDS coordinates: 1-831 (+)
• Peptide sequence: PMSVLLSCSSPFSLLKTSPPTHSFPKPSSLSFFRFSPPSLSLHSTPSNTSISIRASTQVGAAGSEPPIADRVSEFKDACWRFLRPHTIRGTALGSTALVARALIENPSLIKWSLLLKALSGLFALICGNGYIVGINQIYDISIDKVNKPYLPIAAGDLSVQSAWLLITFFAAAGLVTVGLNFGPFIFSLYTLGLFLGTIYSVPPLRMKRFPVAAFLIIATVRGFLLNFGVYYATRASLGLAFEWSSPVVFITTFVTLFALVIAITKDLPDVEGDLK*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_425474

• Blastp: Homogentisate solanesyltransferase, chloroplastic from Arabidopsis with 84.58% of identity
• Blastx: Homogentisate solanesyltransferase, chloroplastic from Arabidopsis with 84.96% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (AT3G11945)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019444163.1)
• Pfam: UbiA prenyltransferase family (PF01040.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;