Protein coding transcript 8384

• Transcript: Ll_transcript_425479
• CDS coordinates: 1432-1914 (+)
• Peptide sequence: MKRFPVAAFLIIATVRGFLLNFGVYYATRASLGLAFEWSSPVVFITTFVTLFALVIAITKDLPDVEGDLKYQISTFATKLGVRNIAFLGSGILVMNYVFSILAAIYMPQAFRQWLLIPAHMIFALSLIFQARVLEQANYTKVTYCLLLQQNSAVTLSLVS*
• ORF Type: complete

Annotations of Ll_transcript_425479

• Blastp: Homogentisate solanesyltransferase, chloroplastic from Arabidopsis with 79.43% of identity
• Blastx: Homogentisate solanesyltransferase, chloroplastic from Arabidopsis with 81.23% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (AT3G11945)
• CantataDB: Link to cantataDB annotations (CNT0001184)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019444163.1)
• Pfam: UbiA prenyltransferase family (PF01040.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;