Transcript | Ll_transcript_279211 |
---|---|
CDS coordinates | 88-969 (+) |
Peptide sequence | MVRPIMVRLTRDNKAPEFEMGGCVVCRQNDFSVAKFDERTVIICDQCEKEYHVGCLWDIGLCELEELPKDKWFCCDDCNRIYLALKNSVSAGADIIQTSLLELIIKKREERGLCTYEGMSDIQWRILRGKSRCAEHLPILSRAAEIFRECFDPIVAISGRDLIPVMVYGRNISGQEFGGMYCIVLIVNSVVVSAGLLRIFGCNVAELPLVATSREYQGKGYFQALFSCIERLLSSLNVEKLVLPAAGDAESIWTKKLGFRKMTEDQVILLAFYWLTTGIRYPESRFPENQMNP* |
ORF Type | complete |
Blastp | Increased DNA methylation 1 from Arabidopsis with 28.9% of identity |
---|---|
Blastx | Increased DNA methylation 1 from Arabidopsis with 28.9% of identity |
Eggnog | PHD(ENOG410Y0W7) |
Kegg | Link to kegg annotations (AT3G14980) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019461091.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer