Transcript | Ll_transcript_279213 |
---|---|
CDS coordinates | 1-1053 (+) |
Peptide sequence | LASGQNLTTGDSDDMCAICGDGGDLILCNGCPRAFHAACLGFDCAPESSWHCLNCRDNVGNGRESSMARPIMIRLTQVDKAPEFEMGGCIVCRQHDFSVAKFDERTVIICDQCEKEYHVGCLRDIGLCELEELPKDKWFCCEDCNRIYVALQNSVSAGADIIPTSLSELIIKKHEERGLCTYEGMNGIQWRILSGKSRYPEHLPLLSRAAAIFRECFDPIVALSGRDLIPVMVYGRNISGQEFGGMYCIVLIVNSVVVSAGLLRIFGCNVAELPLVATSREYQGKGYFQALFSCIERLLSSLNVEKLVLPAAGDAESIWTKKLGFRKMSEDQVFLLFTGLGELDIMEPFY* |
ORF Type | 5prime_partial |
Blastp | Increased DNA methylation 1 from Arabidopsis with 30.89% of identity |
---|---|
Blastx | Increased DNA methylation 1 from Arabidopsis with 30.89% of identity |
Eggnog | PHD(ENOG410Y0W7) |
Kegg | Link to kegg annotations (AT3G14980) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019428220.1) |
Pfam | PHD-finger (PF00628.28) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer