Protein coding transcript 83845

• Transcript: Ll_transcript_279223
• CDS coordinates: 1-663 (+)
• Peptide sequence: LASGQNLTTGDSDDMCAICGDGGDLILCNGCPRAFHAACLGFDCAPESSWHCLNCRDNVGNGRESSMARPIMIRLTQVDKAPEFEMGGCIVCRQHDFSVAKFDERTVIICDQCEKEYHVGCLRDIGLCELEELPKDKWFCCEDCNRIYVALQNSVSAGADIIPTSLSELIIKKHEERGLCTYEGMSDIQWRILRGKSRCAEHLPILSRAAEIFRVSISGF*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_279223

• Blastp: Chromodomain-helicase-DNA-binding protein 4 from Mus with 32.41% of identity
• Blastx: Chromodomain-helicase-DNA-binding protein 4 from Mus with 32.41% of identity
• Eggnog: helicase(COG0553)
• Kegg: Link to kegg annotations (107932)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019428224.1)
• Pfam: PHD-finger (PF00628.28)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;