Protein coding transcript 83847

• Transcript: Ll_transcript_279232
• CDS coordinates: 1-1035 (+)
• Peptide sequence: LASGQNLTTGDSDDMCAICGDGGDLILCNGCPRAFHAACLGFDCAPESSWHCLNCRDNVGNGRESSMARPIMIRLTQVDKAPEFEMGGCIVCRQHDFSVAKFDERTVIICDQCEKEYHVGCLRDIGLCELEELPKDKWFCCEDCNRIYVALQNSVSAGADIIPTSLSELIIKKHEERGLCTYEGMNGIQWRILSGKSRYPEHLPLLSRAAAIFRECFDPIVALSGRDLIPVMVYGRNISGQEFGGMYCIVLIVNSVVVSAGLLRIFGCNVAELPLVATSREYQGKGYFQALFSCIERLLSSLNVEKLVLPAAGDAESIWTKKLGFRKMSEDQLSKYLREVQLTLF
• ORF Type: internal

Annotations of Ll_transcript_279232

• Blastp: Increased DNA methylation 1 from Arabidopsis with 30.88% of identity
• Blastx: Increased DNA methylation 1 from Arabidopsis with 30.88% of identity
• Eggnog: PHD(ENOG410Y0W7)
• Kegg: Link to kegg annotations (AT3G14980)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019428220.1)
• Pfam: PHD-finger (PF00628.28)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;