Transcript | Ll_transcript_279622 |
---|---|
CDS coordinates | 44-619 (+) |
Peptide sequence | MASFKLFVYLLSLLAFHLFPSPVFSRDEKKDLLHDLNRYRQLLNLPILTEHHKASCLANEIAEDLEHKPCQDFNYYPVPGIHPKSPNFQENIDKCKININTTNDAIIMPVCVHNLDSDALFLNYTKTYRFTKYLNSSKYTIAGLGSEDDWMVLVLSTNSSSGEFSSATSLLAHAWKGYCLVLALFFTAFFV* |
ORF Type | complete |
Blastp | Uncharacterized GPI-anchored protein At3g06035 from Arabidopsis with 43.62% of identity |
---|---|
Blastx | Uncharacterized GPI-anchored protein At3g06035 from Arabidopsis with 43.62% of identity |
Eggnog | (GPI)-anchored protein(ENOG410YJI0) |
Kegg | Link to kegg annotations (AT3G06035) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019426799.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer