Protein coding transcript 83966

• Transcript: Ll_transcript_279919
• CDS coordinates: 2-343 (+)
• Peptide sequence: EPILLEVDQIYHLACPASPIHYKYNPVKTIKTNVMGTLNMLGLAKRVGARFLITSTSEVYGDPLEHPQKETYWGNVNPIGERSCYDEGKRTAETLTMDYHRGAGVEVTCLCIS*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_279919

• Blastp: UDP-glucuronic acid decarboxylase 1 from Arabidopsis with 93.75% of identity
• Blastx: UDP-glucuronic acid decarboxylase 1 from Arabidopsis with 93.75% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (AT3G53520)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019428661.1)
• Pfam: Male sterility protein (PF07993.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;