Protein coding transcript 83970

• Transcript: Ll_transcript_279928
• CDS coordinates: 251-928 (+)
• Peptide sequence: MGTLNMLGLAKRTGARFLLTSTSEVYGDPLEHPQKETYWGNVNPIGERSCYDEGKRTAETLTMDYHRGAGVEVRIARIFNTYGPRMCLDDGRVVSNFVAQAIRKQPLTVYGDGKQTRSFQYVSDLVNGLTALMDGEHIGPFNLGNPGEFTMLELAKIVKETIDSSATIAYKPNTADDPHMRKPDISKAKELLNWEPKIPLREGLPLMVSDFRNRILNEDEGKGLK*
• ORF Type: complete

Annotations of Ll_transcript_279928

• Blastp: UDP-glucuronic acid decarboxylase 1 from Arabidopsis with 90.62% of identity
• Blastx: UDP-glucuronic acid decarboxylase 1 from Arabidopsis with 90.79% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (AT3G53520)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019436844.1)
• Pfam: GDP-mannose 4,6 dehydratase (PF16363.4)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;