Transcript | Ll_transcript_279928 |
---|---|
CDS coordinates | 251-928 (+) |
Peptide sequence | MGTLNMLGLAKRTGARFLLTSTSEVYGDPLEHPQKETYWGNVNPIGERSCYDEGKRTAETLTMDYHRGAGVEVRIARIFNTYGPRMCLDDGRVVSNFVAQAIRKQPLTVYGDGKQTRSFQYVSDLVNGLTALMDGEHIGPFNLGNPGEFTMLELAKIVKETIDSSATIAYKPNTADDPHMRKPDISKAKELLNWEPKIPLREGLPLMVSDFRNRILNEDEGKGLK* |
ORF Type | complete |
Blastp | UDP-glucuronic acid decarboxylase 1 from Arabidopsis with 90.62% of identity |
---|---|
Blastx | UDP-glucuronic acid decarboxylase 1 from Arabidopsis with 90.79% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (AT3G53520) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019436844.1) |
Pfam | GDP-mannose 4,6 dehydratase (PF16363.4) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer