Protein coding transcript 83994

• Transcript: Ll_transcript_280172
• CDS coordinates: 1663-2274 (+)
• Peptide sequence: MFSLVKNGTMSCSLNPTIWKVVTLNECLGSDFFFRNHNRDTRRRTAQAAKRIIATREKGLCLEQEGRILITGLHRPGLPVKPAKYTSWLKPEGTFPYNLLPETLNWFSVRFINSTGISLVREFMARSRYVNCGKSPSSGGIELLNWLCDKFNSVNSVHELTLLGISPVNMFSCIRRFCNFFNRVRHAGASPLNMFLLMSIFIS*
• ORF Type: complete

Annotations of Ll_transcript_280172

• Blastp: LRR receptor-like serine/threonine-protein kinase HSL2 from Arabidopsis with 55.85% of identity
• Blastx: LRR receptor-like serine/threonine-protein kinase HSL2 from Arabidopsis with 55.31% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT5G65710)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019444967.1)
• Pfam: Leucine rich repeat (PF13855.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;