| Transcript | Ll_transcript_279976 |
|---|---|
| CDS coordinates | 1-348 (+) |
| Peptide sequence | VVNFFGRISILIDQNTQAFHLFMTALLQLFDRSGVLYGELARFVLRLLGIKTKQRKVNPQGPNGHPLGPNGHPLGPNGQPLPLPHNPSGNMNYIEGPKAAPSGAWDNVWGNDPNQ* |
| ORF Type | 5prime_partial |
| Blastp | Peroxisomal membrane protein 13 from Arabidopsis with 63.79% of identity |
|---|---|
| Blastx | Peroxisomal membrane protein 13 from Arabidopsis with 56.14% of identity |
| Eggnog | glycine-rich protein(ENOG4111WZ3) |
| Kegg | Link to kegg annotations (AT3G07560) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019448254.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer