Protein coding transcript 84060

• Transcript: Ll_transcript_279978
• CDS coordinates: 437-757 (+)
• Peptide sequence: MNYNSGYGAGMYGSSLGGLGGGLYGGGGMYGNSMYRGGYGGGLYGSSGMYGGGMYNSGLGGPMGGYGMGGGPYGDQDPNNPYGAPPSPPGFWISALRVVSHMILFR*
• ORF Type: complete

Annotations of Ll_transcript_279978

• Blastp: Peroxisomal membrane protein 13 from Arabidopsis with 63.33% of identity
• Blastx: Peroxisomal membrane protein 13 from Arabidopsis with 56.1% of identity
• Eggnog: glycine-rich protein(ENOG4111WZ3)
• Kegg: Link to kegg annotations (AT3G07560)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019436526.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;