Protein coding transcript 84062

• Transcript: Ll_transcript_279980
• CDS coordinates: 2155-2853 (+)
• Peptide sequence: MQQAAAVVNSGLLLMAVMGLLFPAVLHFTHSELHFGKSVLSLSRFSSCIMLLAYASYLFFQLRSQQNLYSPVHEVADNSEISDEEEELELTKWEAIVWLAILTAWVSVLSGYLVDAIEGASESLNMSMAFISVILLPIVGNAAEHASAIMFAMKDKLDITIGVAVGSSTQISMFVIPFCVVVGWCMGKEMDLNFQLFETTTLFITVLVVAFMMQVFDSFFPLRSCFIRGCKC*
• ORF Type: complete

Annotations of Ll_transcript_279980

• Blastp: Vacuolar cation/proton exchanger 5 from Arabidopsis with 73.36% of identity
• Blastx: Vacuolar cation/proton exchanger 2 from Oryza sativa with 69.13% of identity
• Eggnog: Calcium Proton(COG0387)
• Kegg: Link to kegg annotations (AT1G55730)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019436160.1)
• Pfam: Sodium/calcium exchanger protein (PF01699.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;