Protein coding transcript 84063

• Transcript: Ll_transcript_279981
• CDS coordinates: 148-912 (+)
• Peptide sequence: MAQPSASPPPKPWEQAGSSSGPAPFKPPSAGATSDVVEASGTARPGEIVSSADRDPATANRNALGRPVPTRPWENSYGNSSYGGYGSTMNYNSGTGMYGSSYGGIGGSSYGGLGGGMYGGGMYGNSMYRGGGYGGGLYGSSGMYGGGGMYNSGLGGPMGGYGMGGGMGGPYGDQDPNNPYGAPPTPPGFWISALRVLQGVVNFFGRISILIDQNTQAFHLFMTALLQVSCSPFCLLFYYFVQLLIVAVSRLTLK*
• ORF Type: complete

Annotations of Ll_transcript_279981

• Blastp: Peroxisomal membrane protein 13 from Arabidopsis with 73.68% of identity
• Blastx: Peroxisomal membrane protein 13 from Arabidopsis with 58.11% of identity
• Eggnog: glycine-rich protein(ENOG4111WZ3)
• Kegg: Link to kegg annotations (AT3G07560)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019448255.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;