Transcript | Ll_transcript_279969 |
---|---|
CDS coordinates | 910-1296 (+) |
Peptide sequence | MQQAAAVVNSGLLLMAVMGLLFPAVLHFTHSELHFGKSVLSLSRFSSCIMLLAYASYLFFQLRSQQNLYSPVHEVADNSEISDEEEELELTKWEAIVWLAILTAWVSVLSGYLVDAIEGASESLNMSMA |
ORF Type | 3prime_partial |
Blastp | Vacuolar cation/proton exchanger 2 from Arabidopsis with 69.77% of identity |
---|---|
Blastx | Vacuolar cation/proton exchanger 2 from Oryza sativa with 64.05% of identity |
Eggnog | Calcium Proton(COG0387) |
Kegg | Link to kegg annotations (AT3G13320) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019436160.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer