Protein coding transcript 84076

• Transcript: Ll_transcript_279974
• CDS coordinates: 483-1112 (+)
• Peptide sequence: MDLLLLLNRQLAFYTGPTVGGLLNATFGNATEMIISIYALKNGMIRVVQQSLLGSILSNMLLVLGCAFFTGGIVHHNKVQVFNKAAAVVNSGLLLMAVMGLLFPAVLHFTHSELHFGKSVLSLSRFSSCIMLLAYASYLFFQLRSQQNLYSPVHEVADNSEISDEEEELELTKWEAIVWLAILTAWVSVLSGYLVDAIEGASESLNMSMA
• ORF Type: 3prime_partial

Annotations of Ll_transcript_279974

• Blastp: Vacuolar cation/proton exchanger 2 from Arabidopsis with 74.51% of identity
• Blastx: Vacuolar cation/proton exchanger 2 from Oryza sativa with 71.81% of identity
• Eggnog: Calcium Proton(COG0387)
• Kegg: Link to kegg annotations (AT3G13320)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019436160.1)
• Pfam: Sodium/calcium exchanger protein (PF01699.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;