Protein coding transcript 84079

• Transcript: Ll_transcript_280561
• CDS coordinates: 1340-2041 (+)
• Peptide sequence: MKAGISVLKKIDSVLGGFDGTRYVTERKWAPALDGTLIPISIVYRKDLVKLDGSDPLLLYGYGSYEACIEPGFKSSRLSLLDRGFIYAIAHIRGGGEMGRQWYENGKLLKKKNTFTDFIASAEYLIENKFCSTEKLCIDGRSAGGLLIGAVLNMRPNLFKAAIAGVPFVDVVTTMLDPTIPLTTSEWEEWGDPRKEEFYFYMKTYSPVDNVRNSWLCFMAISSYFDPILVLCR*
• ORF Type: complete

Annotations of Ll_transcript_280561

• Blastp: Dipeptidyl aminopeptidase BI from Pseudoxanthomonas with 56.85% of identity
• Blastx: Protease 2 from Moraxella with 38.93% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019428332.1)
• Pfam: Prolyl oligopeptidase family (PF00326.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;