Transcript | Ll_transcript_280562 |
---|---|
CDS coordinates | 1-753 (+) |
Peptide sequence | RKGNYYYYVKNLEGKEYVQYCRRLIPHNQKVPSVYDIMPTGPEAPHEHVILDENINAQNYQYYSIGAFKVSPNNKLVAYAEDTKGNEVYSVHVIDAETKTLIGEPLVGVTSYLEWAGDDSLIYITTDETLRPDKVWLHVLGTEQSNDTCLYVEKDDMFSVDLYASESKQYLFVASESKNTRFNFYLDVLKPGEGLKILTSRVDGIDTTISHRGDHFFIKRRSDQFFNSEVVACPVDNTSSTTVLLPHRER* |
ORF Type | 5prime_partial |
Blastp | Dipeptidyl aminopeptidase BI from Pseudoxanthomonas with 29.88% of identity |
---|---|
Blastx | Protease 2 from Moraxella with 53.71% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019452573.1) |
Pfam | Prolyl oligopeptidase, N-terminal beta-propeller domain (PF02897.14) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer