Protein coding transcript 84081

• Transcript: Ll_transcript_280563
• CDS coordinates: 1-1089 (+)
• Peptide sequence: RKGNYYYYVKNLEGKEYVQYCRRLIPHNQKVPSVYDIMPTGPEAPHEHVILDENINAQNYQYYSIGAFKVSPNNKLVAYAEDTKGNEVYSVHVIDAETKTLIGEPLVGVTSYLEWAGDDSLIYITTDETLRPDKVWLHVLGTEQSNDTCLYVEKDDMFSVDLYASESKQYLFVASESKNTRFNFYLDVLKPGEGLKILTSRVDGIDTTISHRGDHFFIKRRSDQFFNSEVVACPVDNTSSTTVLLPHRESVKIQEIQLFSDHLVAYERENGLQKITIYHLPPIGESLRSLEDGQAVNFIDPVYSVYLSESEFSSSILRFSYSSLKTPSSVYDYDMKASISVLKKIDSVIKIPSCTILHFIMH*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_280563

• Blastp: Dipeptidyl aminopeptidase BI from Pseudoxanthomonas with 29.07% of identity
• Blastx: Dipeptidyl aminopeptidase BI from Pseudoxanthomonas with 55.28% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019452573.1)
• Pfam: Prolyl oligopeptidase, N-terminal beta-propeller domain (PF02897.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;