Protein coding transcript 84175

• Transcript: Ll_transcript_278170
• CDS coordinates: 57-1112 (+)
• Peptide sequence: MSLPDSSFSVDNSTKYDDDGRIKRTGTWVTASAHIVTAVIGSGVLSLAWAVAQLGWIAGPIILVIFSVITLYTSCLLSDCYRSPDPITGTRNRKYITMVKNILGGVQYKLCGWAQYGSLIGVTIGYSITAAISMVAIKRSNCFHKNGHQAKCHSANYPFMVIFGVIQILLSQIPDFHELSWLSILAAIMSFGYATIGVGLSIAKIAEGEHVTTSLTGTHVGVDVTSNQKIWNVFQSIGNIAFAYAFSVVLVEIQDTLKSSPPENKAMKKATVTGVSVTTTFYMLCGLLGYAAFGNDAPGNFLTGFGFYEPFWLVDIGNIFIVIHLVGAYQVSSSMNKSCYNFGSSTLLVEY*
• ORF Type: complete

Annotations of Ll_transcript_278170

• Blastp: Amino acid permease 6 from Arabidopsis with 69.28% of identity
• Blastx: Amino acid permease 1 from Arabidopsis with 66.26% of identity
• Eggnog: amino acid transport(COG0814)
• Kegg: Link to kegg annotations (AT5G49630)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019427958.1)
• Pfam: Transmembrane amino acid transporter protein (PF01490.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;