Protein coding transcript 84177

• Transcript: Ll_transcript_278173
• CDS coordinates: 272-880 (+)
• Peptide sequence: MKKATVTGVAVTTTFYMLCGILGYSAFGNNAPGNFLTGFGFYEPFWLVDIGNIFIIIHLVGAYQVFAQPIFDLVETTCAKRWPEKEFITKEYIVNLPMIGPFRINLFRSTWRTFYVIFTTILAILLPFFNSIVGLLGAISFWPLTVYFPTEMHLVQAKVPKFSMTWIGLKSLTMFCLIVTLLAIAGSIEGIVTELKTYEPFS*
• ORF Type: complete

Annotations of Ll_transcript_278173

• Blastp: Amino acid permease 1 from Arabidopsis with 60.7% of identity
• Blastx: Amino acid permease 1 from Arabidopsis with 59.48% of identity
• Eggnog: amino acid transport(COG0814)
• Kegg: Link to kegg annotations (AT1G58360)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019427958.1)
• Pfam: Transmembrane amino acid transporter protein (PF01490.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;