Protein coding transcript 84193

• Transcript: Ll_transcript_280506
• CDS coordinates: 3-1076 (+)
• Peptide sequence: CSFTNPKYQTLARTQTQASSSGSHEPHHPLAVNHTLYSHSPAVMTEPHHSHDTLPSSVVQTKQKKLRKRKRARKTEQLNHQLEEQENKDGEESLEEENDANMSGGDVREEQNLEDGDGNNNEGEEGGENVASGIMSVESFESLGLSEPTYKAVMDMGFHHMTQIQARSIPPLLIGKDVLGAARTGAGKTLAFLIPAVELLHGIQFTPRSGTGVVVICPTRELAIQTHAVAKELLRYHSQTLGLVIGGAGRKGEAERIVKGVNLLVATPGRLLDHLQNTKGFIYKNLKCLIIDEADRILEANFEEEMKQIINILPKVSVLLNLLIFFFLSPVLSCNSVTNIYCGNETVSCPSPLPLCG*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_280506

• Blastp: DEAD-box ATP-dependent RNA helicase 27 from Oryza sativa with 71.35% of identity
• Blastx: DEAD-box ATP-dependent RNA helicase 27 from Arabidopsis with 72.28% of identity
• Eggnog: purine NTP-dependent helicase activity(COG0513)
• Kegg: Link to kegg annotations (4334469)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019437092.1)
• Pfam: DEAD/DEAH box helicase (PF00270.28)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;