Protein coding transcript 842

• Transcript: Ll_transcript_332869
• CDS coordinates: 3-377 (+)
• Peptide sequence: QIQSATTAANQPTGNADDLVTSIFTLALGDDANAAFLRELALRNGGKFQQIYEAADASVELQKFYESISSPLLTNVTVTFDYKQAVESSVTQKDFRTYFWGSELVVAGRILPGQGDIISGVVTAT
• ORF Type: internal

Annotations of Ll_transcript_332869

• Blastp: Inter-alpha-trypsin inhibitor heavy chain H2 from Homo with 45.19% of identity
• Blastx: Inter-alpha-trypsin inhibitor heavy chain H2 from Homo with 45.19% of identity
• Eggnog: von Willebrand factor, type A(COG2304)
• Kegg: Link to kegg annotations (3698)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_004488095.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;