Protein coding transcript 84251

• Transcript: Ll_transcript_280099
• CDS coordinates: 1690-2049 (+)
• Peptide sequence: MFAIFYVFISLMSLFFNNHLNVLFYFVDTDPLLSPSYVPFIFGIIVPFLVECRFLVPADLTVGQFVYVVRKRIKLSSEKAIFIFVKNILPPTAAMMSAIYEENKDEDGFLYMTYSGENTF
• ORF Type: 3prime_partial

Annotations of Ll_transcript_280099

• Blastp: Autophagy-related protein 8c from Arabidopsis with 85.33% of identity
• Blastx: Autophagy-related protein 8c from Arabidopsis with 85.33% of identity
• Eggnog: Microtubule-associated protein 1 light chain 3(ENOG4111JAT)
• Kegg: Link to kegg annotations (AT1G62040)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019451216.1)
• Pfam: Autophagy protein Atg8 ubiquitin like (PF02991.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;