Protein coding transcript 84282

• Transcript: Ll_transcript_280267
• CDS coordinates: 212-715 (+)
• Peptide sequence: MTTKAPRPRTRVGKYELGKTIGEGSFAKVKLARNVDTRDHVAIKILDRDHVLRHNMMEQLKKEISAMKLINHPNVVKIFEVMASKTKIYIVLELVRGGELFDKIASSGRLKEDEARSYFQQLINAVDYCHSRGVYHRDLKPENLLLDSNGVLKVSDFGLSTYAQQVR*
• ORF Type: complete

Annotations of Ll_transcript_280267

• Blastp: CBL-interacting serine/threonine-protein kinase 9 from Arabidopsis with 79.63% of identity
• Blastx: CBL-interacting serine/threonine-protein kinase 9 from Arabidopsis with 79.63% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT1G01140)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019461228.1)
• Pfam: Protein kinase domain (PF00069.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;