Protein coding transcript 843

• Transcript: Ll_transcript_332871
• CDS coordinates: 1-474 (+)
• Peptide sequence: PAAAPAAAAPGGAVKKAHSAKKPSLQKKTHAGVKKQTLKGKGQKKKKVSLRYVIDCTHPYEDKIIDVANFEKYLQERIKVNGKTNNFGNNLQLERNKMKIIVTSDIHMSKRYLKYLTKKYLKKNNLRDWLRVVASAKDTYELRYFQFNSQEDEDDEEE
• ORF Type: internal

Annotations of Ll_transcript_332871

• Blastp: 60S ribosomal protein L22 from Sophophora with 69.05% of identity
• Blastx: 60S ribosomal protein L22 from Sophophora with 67.57% of identity
• Eggnog: Ribosomal protein(ENOG4111UVJ)
• Kegg: Link to kegg annotations (Dmel_CG7434)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020206190.1)
• Pfam: Ribosomal L22e protein family (PF01776.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;