Protein coding transcript 84316

• Transcript: Ll_transcript_278938
• CDS coordinates: 2-625 (+)
• Peptide sequence: IAKAFGFASSGVTVTCSLQADLKDLAHKCVEATKIAGFALATSALVVSGASAEGVPKRLTYDEIQSKTYLEVKGTGTANQCPTIDGGADSFSFPSGKYTAKKFCLEPTSFTVKAEGVTKNAPLEFQNTKLMTRLTYTLDEIEGPFEVSPDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPESFSGDFLVPSYRGSSF
• ORF Type: internal

Annotations of Ll_transcript_278938

• Blastp: Oxygen-evolving enhancer protein 1, chloroplastic from Pisum with 87.5% of identity
• Blastx: Oxygen-evolving enhancer protein 1, chloroplastic from Pisum with 87.5% of identity
• Eggnog: -
• Kegg: -
• CantataDB: Link to cantataDB annotations (CNT0000045)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019424234.1)
• Pfam: Manganese-stabilising protein / photosystem II polypeptide (PF01716.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;