Transcript | Ll_transcript_278843 |
---|---|
CDS coordinates | 1-519 (+) |
Peptide sequence | NNILHSFVLVKPMDFYYYYYVVNLLCVIYFRFQVKKKQFFVNFITIVMFGAVGTLICWTIITFGAIQTFKRMGIDSLELEDYLAIGAIFAATDSVCTLQVLNQDETPLLYSLVFGEGVVNDATSVVLFNAIKSFDLNHIDPGVALQFVGNFLYLFIASTMLGVLVTLLLPLIL |
ORF Type | internal |
Blastp | Sodium/hydrogen exchanger 3 from Arabidopsis with 66.06% of identity |
---|---|
Blastx | Sodium/hydrogen exchanger 3 from Arabidopsis with 72.88% of identity |
Eggnog | Sodium hydrogen exchanger(COG0025) |
Kegg | Link to kegg annotations (AT3G06370) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019423274.1) |
Pfam | Sodium/hydrogen exchanger family (PF00999.20) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer