Protein coding transcript 84462

• Transcript: Ll_transcript_278557
• CDS coordinates: 67-717 (+)
• Peptide sequence: MGEEKKTKVAVWPTIKPFVNGGVSGMLATSVIQPIDMIKVRIQLGQGSAAHITTTMLKNEGVAAFYKGLSAGLLRQATYTTARLGSFRILTNKAIEANDGKPLPLYQKALCGLTAGAIGATVGSPADLALIRMQADATLPAAQRRHYTNAFHALFRISKDEGVLALWKGAGPTVVRAMALNMGMLASYDQSVEFFRDNVGLGEAATVVGKYPFYYC*
• ORF Type: complete

Annotations of Ll_transcript_278557

• Blastp: Mitochondrial dicarboxylate/tricarboxylate transporter DTC from Arabidopsis with 85.65% of identity
• Blastx: Mitochondrial dicarboxylate/tricarboxylate transporter DTC from Arabidopsis with 85.65% of identity
• Eggnog: Mitochondrial(ENOG410XQHU)
• Kegg: Link to kegg annotations (AT5G19760)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019444999.1)
• Pfam: Mitochondrial carrier protein (PF00153.26)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;