Protein coding transcript 84487

• Transcript: Ll_transcript_278301
• CDS coordinates: 190-663 (+)
• Peptide sequence: MDVKDLTLAHVKSHLQMYRTVKTTNKPPASSGLSDGSGEDDMSPIGSSGSGGPRQFPDQRSIPDRPVQQDMDYTSTTTTTLWSNSSSREPWPQTSANDIGGFRPPIFQSQPLSGGHQIQECDSTQLKNSLSGSNLECKNPSLEFTLGRPDWNGKGQA*
• ORF Type: complete

Annotations of Ll_transcript_278301

• Blastp: Transcription repressor KAN1 from Arabidopsis with 46.47% of identity
• Blastx: Transcription repressor KAN1 from Arabidopsis with 43.26% of identity
• Eggnog: Transcription factor(ENOG410YB3T)
• Kegg: Link to kegg annotations (AT5G16560)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019419896.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;