Protein coding transcript 845

• Transcript: Ll_transcript_332848
• CDS coordinates: 1-462 (+)
• Peptide sequence: LVNIQAQLKNDVKLNDYLINPSIKKNIKVDAIKAAAKQTNMSAPVTNLLSLMAENNRLKLLNGTINAFKQIMAAARGEVTCEVTTAKPLDAALLKEIEGALKGFVKSNQKILLSTKIDPSIIGGMLVTIGDKYVDMSIASKVRKYSKIIGDSA*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_332848

• Blastp: ATP synthase subunit O, mitochondrial from Sophophora with 50.98% of identity
• Blastx: ATP synthase subunit O, mitochondrial from Sophophora with 52.05% of identity
• Eggnog: F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation (By similarity)(COG0712)
• Kegg: Link to kegg annotations (Dmel_CG4307)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_015936928.1)
• Pfam: ATP synthase delta (OSCP) subunit (PF00213.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;