Protein coding transcript 84516

• Transcript: Ll_transcript_278796
• CDS coordinates: 1437-2405 (+)
• Peptide sequence: MHCDMNSRCSSIAWVPGGDGAFVVAHADGNLYVYEKNKDGAGDSSFPVIKDQTQFSVSHSRYNKSNPVARWHICQGSINSISFSNDGAYLATVGRDGYLRVFDYSKELLVCGGKSYYGALLCCAWSMDGKYILTGGEDDLVQVWSMEDRKVVAWGEGHSSWVSGVAFDSYWTSPNSGDNGETIMYRFGSVGQDTQLLLWDLEMDEIVVPLRRPPGGSPTYSTGSQSSHWDNVVPLGTLQPAPSMRDVPKVSPLVTHRVHTEPLSGLIFTQESVLTACREGQIKVWVRPDIAESQSSNSETLLATSLKEKPSLSSKITNSSYK*
• ORF Type: complete

Annotations of Ll_transcript_278796

• Blastp: Probable catabolite repression protein creC from Aspergillus with 36.16% of identity
• Blastx: Probable catabolite repression protein creC from Aspergillus with 36.16% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (ANI_1_388094)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019444349.1)
• Pfam: WD domain, G-beta repeat (PF00400.31)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;