Transcript | Ll_transcript_278459 |
---|---|
CDS coordinates | 380-1693 (+) |
Peptide sequence | MDSRFKTDPQLRRALCYGNVARQQERSPSVIVIGGGMAGTAAARALQDASFQVVLLESRERLGGRIHTDYSFGFPVDLGASWLHGVCKENPLAPLIGKLGLPLYRTSEDNSVLYDHDLESYALFDMDGNQVPLELVTEVGKLFERVLEETNKIRQEFIEDMSILRALSIVFERKPEFRLEGLAHKVLQWYLCRMEGWFAADSDSISLKNWDQEVLLPGGHGLMVRGYLPVIHTLAKGIDIRLGHRVTKIVRRYNEVKVITENGETFVADAAIVAVPLGVLKANIIEFEPKLPDWKEAAITDLGVGIENKIILHFENVFWPNVEFLGVVAETSYGCSYFLNLHKATGHPVLVYMPAGQLAKDIEKMSDEAAANFAFTQLKKILPDASSPIQYLVSRWGTDINSLGSYSYDAVHKPNDLYERLRVPVDNLFFAGEATSML |
ORF Type | 3prime_partial |
Blastp | Polyamine oxidase 3 from Arabidopsis with 78.95% of identity |
---|---|
Blastx | Probable polyamine oxidase 2 from Arabidopsis with 80.28% of identity |
Eggnog | Polyamine oxidase(ENOG410XQHS) |
Kegg | Link to kegg annotations (AT3G59050) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019455951.1) |
Pfam | FAD dependent oxidoreductase (PF01266.23) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer