Protein coding transcript 84580

• Transcript: Ll_transcript_278462
• CDS coordinates: 1879-2421 (+)
• Peptide sequence: MEYFLPLLVALCYGNVARQQERSPSVIVIGGGMAGTAAARALQDASFQVVLLESRERLGGRIHTDYSFGFPVDLGASWLHGVCKENPLAPLIGKLGLPLYRTSEDNSVLYDHDLESYALFDMDGNQVPLELVTEVGKLFERVLEETNKIRQEFIEDMSILRALSIVFERKPEFRLLLVPN*
• ORF Type: complete

Annotations of Ll_transcript_278462

• Blastp: Polyamine oxidase 3 from Arabidopsis with 74.25% of identity
• Blastx: Probable polyamine oxidase 2 from Arabidopsis with 75.76% of identity
• Eggnog: Polyamine oxidase(ENOG410XQHS)
• Kegg: Link to kegg annotations (AT3G59050)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019455951.1)
• Pfam: FAD binding domain (PF00890.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;