Transcript | Ll_transcript_278465 |
---|---|
CDS coordinates | 380-934 (+) |
Peptide sequence | MDSRFKTDPQLRRALCYGNVARQQERSPSVIVIGGGMAGTAAARALQDASFQVVLLESRERLGGRIHTDYSFGFPVDLGASWLHGVCKENPLAPLIGKLGLPLYRTSEDNSVLYDHDLESYALFDMDGNQVPLELVTEVGKLFERVLEETNKIRQEFIEDMSILRALSIVFERKPEFRLLLVPN* |
ORF Type | complete |
Blastp | Polyamine oxidase 3 from Arabidopsis with 72.78% of identity |
---|---|
Blastx | Probable polyamine oxidase 2 from Arabidopsis with 74.16% of identity |
Eggnog | Polyamine oxidase(ENOG410XQHS) |
Kegg | Link to kegg annotations (AT3G59050) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019455951.1) |
Pfam | FAD binding domain (PF00890.23) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer