Transcript | Ll_transcript_279838 |
---|---|
CDS coordinates | 232-1509 (+) |
Peptide sequence | MVVHGGKKLHQMVAGFGGNGLGQVLAAVAVSFLVRLFTAPGPALLPENDNNDDEPENGSHDGEAPHSGMVTPVTIRWNNINCSLSDKSSNVVRFLLKNVSGEAKPGRLLAIMGPSGSGKTTLLNVLAGQLAASQQLHLSGLLEFNGKPSSKNPYKFAYVRQEDLFFSQLTVRETLSLATELQLPNISSAEERDEYVNNLLFKLGLVSCADTNVGDAKVRGISGGEKKRLSMACELLASPSVIFADEPTTGLDAFQAEKVMETLQQLAQDGHTVICSIHQPRGSVYSKFDDIVLLTQGSLVYAGPASDEPLAYFSKFGYDCPEHVNPAEFLADLISIDYSSADSVYSSKKRIDGLVESFSQRLSTVIYATPIIIDDLSKSRKQITKRTVAKKKGSWWKQFWLLLKRAWMQVCLFLLIFSIYSYGRM* |
ORF Type | complete |
Blastp | ABC transporter G family member 7 from Arabidopsis with 75.07% of identity |
---|---|
Blastx | ABC transporter G family member 7 from Arabidopsis with 74.73% of identity |
Eggnog | (ABC) transporter(COG1131) |
Kegg | Link to kegg annotations (AT2G01320) |
CantataDB | Link to cantataDB annotations (CNT0001119) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019428397.1) |
Pfam | Rad17 cell cycle checkpoint protein (PF03215.14) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer