Protein coding transcript 84627

• Transcript: Ll_transcript_279840
• CDS coordinates: 232-1194 (+)
• Peptide sequence: MVVHGGKKLHQMVAGFGGNGLGQVLAAVAVSFLVRLFTAPGPALLPENDNNDDEPENGSHDGEAPHSGMVTPVTIRWNNINCSLSDKSSNVVRFLLKNVSGEAKPGRLLAIMGPSGSGKTTLLNVLAGQLAASQQLHLSGLLEFNGKPSSKNPYKFAYVRQEDLFFSQLTVRETLSLATELQLPNISSAEERDEYVNNLLFKLGLVSCADTNVGDAKVRGISGGEKKRLSMACELLASPSVIFADEPTTGLDAFQAEKVMETLQQLAQDGHTVICSIHQPRGSVYSKFDDIVLLTQGSLVYAGPASDEPLAYFSKFGSSS*
• ORF Type: complete

Annotations of Ll_transcript_279840

• Blastp: ABC transporter G family member 7 from Arabidopsis with 81.05% of identity
• Blastx: ABC transporter G family member 7 from Arabidopsis with 80.92% of identity
• Eggnog: (ABC) transporter(COG1131)
• Kegg: Link to kegg annotations (AT2G01320)
• CantataDB: Link to cantataDB annotations (CNT0001119)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019428396.1)
• Pfam: Rad17 cell cycle checkpoint protein (PF03215.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;