Protein coding transcript 84640

• Transcript: Ll_transcript_279862
• CDS coordinates: 2488-2934 (+)
• Peptide sequence: MIAQDQNNKNNSSQDSIPTGDEQKDSNLPKSNLMPSHSAHVHMPMPWPYNVPPYMYNLQNPIQQMPSYQGYPMANMPSVHPYLPRNMKWPSNQGENQKSSKKKEKSRYKKGPEEYDDQQTESSDPDSESESNSDELRDSNNSLKDDSKR
• ORF Type: 3prime_partial

Annotations of Ll_transcript_279862

• Blastp: Retrovirus-related Pol polyprotein from transposon TNT 1-94 from Nicotiana with 28.73% of identity
• Blastx: Retrovirus-related Pol polyprotein from transposon TNT 1-94 from Nicotiana with 29.1% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019430200.1)
• Pfam: gag-polypeptide of LTR copia-type (PF14244.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;