Protein coding transcript 84650

• Transcript: Ll_transcript_279154
• CDS coordinates: 50-1087 (+)
• Peptide sequence: MLSILQAASGSLNENFLKCLPDQSKTPNPISDVVYTQSNNSFSVILNMHIQNKRFKATTTAKPLAIVTAQRESHVQTTILCAKTHGIQIRIRSGGHDAEGLSYISDVPYVILDLFLLHSVDVDISSATAWVEAGATLGQLYYHIYEKSKVHAFPAGVCTTLGTGGHFSGGGYGNLMRKYGLSVDNIIDAKIVDVNGKILDRKSMGEDLFWAIRGGGGASFGVILSWKIKLVPVPAKVTVFTVKKIVEDGAADVLYKWQEVAPNLDKNLFIKAQHLVVDGTKGGKKTVQVAFIGEFLGTIDRLLPLVSKSFPELGLKKSDCIEMPWINSTLYWYDIPTGTPLETLLT
• ORF Type: 3prime_partial

Annotations of Ll_transcript_279154

• Blastp: Berberine bridge enzyme-like 3 from Arabidopsis with 56.2% of identity
• Blastx: Berberine bridge enzyme-like 5 from Arabidopsis with 54.65% of identity
• Eggnog: FAD linked oxidase domain protein(COG0277)
• Kegg: Link to kegg annotations (AT1G26380)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019445618.1)
• Pfam: FAD binding domain (PF01565.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;