Transcript | Ll_transcript_498692 |
---|---|
CDS coordinates | 196-555 (+) |
Peptide sequence | MAKNSFKLQHPLERRLAEASRIREKYPDRIPVIVEKAERNDIPEIDKKKYLVPADLTVGQFVYVVRKRIKLSAEKAIFVFINDTLPPTAELMSAIYEENKDDDGFLYMTYSGENTFGSN* |
ORF Type | complete |
Blastp | Autophagy-related protein 8C from Oryza sativa with 88.89% of identity |
---|---|
Blastx | Autophagy-related protein 8C from Oryza sativa with 88.89% of identity |
Eggnog | Microtubule-associated protein 1 light chain 3(ENOG4111JAT) |
Kegg | Link to kegg annotations (4344857) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019425923.1) |
Pfam | Autophagy protein Atg8 ubiquitin like (PF02991.15) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer