Protein coding transcript 84671

• Transcript: Ll_transcript_498677
• CDS coordinates: 164-523 (+)
• Peptide sequence: MAKNSFKLQHPLERRLAEASRIREKYPDRIPVIVEKAERNDIPEIDKKKYLVPADLTVGQFVYVVRKRIKLSAEKAIFVFINDTLPPTAELMSAIYEENKDDDGFLYMTYSGENTFGSN*
• ORF Type: complete

Annotations of Ll_transcript_498677

• Blastp: Autophagy-related protein 8C from Oryza sativa with 88.89% of identity
• Blastx: Autophagy-related protein 8C from Oryza sativa with 88.89% of identity
• Eggnog: Microtubule-associated protein 1 light chain 3(ENOG4111JAT)
• Kegg: Link to kegg annotations (4344857)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019425923.1)
• Pfam: Autophagy protein Atg8 ubiquitin like (PF02991.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;