Protein coding transcript 84698

• Transcript: Ll_transcript_499290
• CDS coordinates: 673-1116 (+)
• Peptide sequence: MYSLYLLFVLNDSYLYNLFLQVARRQSEFGLVKSLFVRSYFSVNKFGDHAGKRLLCAQERFQSSYISNLARRVRDADEASEVAHLKELYYRNDPEAVIKLFESQSSLHSNPSALSEYVKALVEVDRLDECELLKTLQKGSARTNMIF*
• ORF Type: complete

Annotations of Ll_transcript_499290

• Blastp: ATP-dependent zinc metalloprotease FTSH 4, mitochondrial from Arabidopsis with 52.76% of identity
• Blastx: ATP-dependent zinc metalloprotease FTSH 4, mitochondrial from Arabidopsis with 52.76% of identity
• Eggnog: Acts as a processive, ATP-dependent zinc metallopeptidase for both cytoplasmic and membrane proteins. Plays a role in the quality control of integral membrane proteins (By similarity)(COG0465)
• Kegg: Link to kegg annotations (AT2G26140)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019437019.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;