Protein coding transcript 84703

• Transcript: Ll_transcript_499266
• CDS coordinates: 427-1392 (+)
• Peptide sequence: MVAAEGGNFKDQLWRTIRSVVVVFLLISGVGALIEDKGISKGLGMSEEVQPSVESNTKFSDVKGVDEAKAELEEIVHYLRDPKRFTRLGGKLPKGVLLVGPPGTGKTMLARAIAGEAGVPFFSCSGSEFEEMFVGVGARRVRDLFSAAKKRSPCIIFIDEIDAIGGSRNPKDQMYMKMTLNQLLVELDGFKQNEGVIVIAATNFPESLDKALVRPGRFDRHVVVPNPDVEGRRQILESHMSKILKADDVDLMIIARGTPGFSGAELANLVNVAALKAAMDGAKAVNMNDLEFAKDKIIMGTERKSAVISEESRKTTAFHEGG
• ORF Type: 3prime_partial

Annotations of Ll_transcript_499266

• Blastp: ATP-dependent zinc metalloprotease FTSH 5, mitochondrial from Oryza sativa with 90.68% of identity
• Blastx: ATP-dependent zinc metalloprotease FTSH 5, mitochondrial from Oryza sativa with 85.29% of identity
• Eggnog: Acts as a processive, ATP-dependent zinc metallopeptidase for both cytoplasmic and membrane proteins. Plays a role in the quality control of integral membrane proteins (By similarity)(COG0465)
• Kegg: Link to kegg annotations (4326311)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019437850.1)
• Pfam: TIP49 C-terminus (PF06068.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;